SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002387498.1.63507 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002387498.1.63507
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0177
Family BRCA2 tower domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002387498.1.63507
Sequence length 100
Comment hypothetical protein [Enterococcus faecalis]; AA=GCF_000147555.1; RF=na; TAX=749503; STAX=1351; NAME=Enterococcus faecalis TX0309A; strain=TX0309A; AL=Scaffold; RT=Major
Sequence
MEENKGLLLTEKNQPIKSIAKQDIYDLKDYLEQLSSWKDPLKLVNKFFENQAIPLNKKKI
MREFHAQARVFNIFYMNFVLSMDTLEEKITKLEEKEKIKV
Download sequence
Identical sequences A0A059N695 A0A0U1ASJ9 E6GT35 E6H7H3
WP_002387498.1.100343 WP_002387498.1.100482 WP_002387498.1.101272 WP_002387498.1.11193 WP_002387498.1.17287 WP_002387498.1.23569 WP_002387498.1.2799 WP_002387498.1.34192 WP_002387498.1.36900 WP_002387498.1.4014 WP_002387498.1.44626 WP_002387498.1.45925 WP_002387498.1.50938 WP_002387498.1.57211 WP_002387498.1.59964 WP_002387498.1.62847 WP_002387498.1.63507 WP_002387498.1.6473 WP_002387498.1.66843 WP_002387498.1.69648 WP_002387498.1.7819 WP_002387498.1.7958 WP_002387498.1.86134 WP_002387498.1.93277 WP_002387498.1.94630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]