SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002389853.1.30586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002389853.1.30586
Domain Number - Region: 71-106
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0942
Family Coiled-coil dimerization domain from cortexillin I 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002389853.1.30586
Sequence length 116
Comment hypothetical protein [Enterococcus faecalis]; AA=GCF_000393375.1; RF=na; TAX=1169311; STAX=1351; NAME=Enterococcus faecalis ATCC 6055; strain=ATCC 6055; AL=Scaffold; RT=Major
Sequence
MQIEIKGKKYNCIFGVKFIRELDKQHGVVRNDVNLGMGLTTLLPQLVSGNIVVLSDVLYT
ATITEKSRPSKDEVDEFVETVDDIEALFDETLKNLEESNAGKLTVRNFKKALMENK
Download sequence
Identical sequences A0A097BYB6 A0A125W5F1 A0A2G9QXT1 D4EIR1 D4EVK7 E2YAG5 E2YJF5 R3KAR5 V7ZNP9
WP_002389853.1.10758 WP_002389853.1.14420 WP_002389853.1.17800 WP_002389853.1.19675 WP_002389853.1.19902 WP_002389853.1.2067 WP_002389853.1.26187 WP_002389853.1.28980 WP_002389853.1.30586 WP_002389853.1.36209 WP_002389853.1.37181 WP_002389853.1.49914 WP_002389853.1.5113 WP_002389853.1.57705 WP_002389853.1.60776 WP_002389853.1.66308 WP_002389853.1.70756 WP_002389853.1.76128 WP_002389853.1.81459 WP_002389853.1.84469 WP_002389853.1.8901 WP_002389853.1.89088 WP_002389853.1.91555 WP_002389853.1.92348 WP_002389853.1.97268 YP_009103082.1.91423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]