SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002399124.1.98652 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002399124.1.98652
Domain Number - Region: 14-59
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0919
Family p53 DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002399124.1.98652
Sequence length 88
Comment hypothetical protein [Enterococcus faecalis]; AA=GCF_000393535.1; RF=na; TAX=1169248; STAX=1351; NAME=Enterococcus faecalis EnGen0329; strain=Merz192; AL=Scaffold; RT=Major
Sequence
MDSSEIIKRVRERVYVEVKKRYKKPDLDIRIRDILYEQSESYEKLVRFSNGKRIKKLADP
VEFEKFMENRGAKIVDEVIVGLNEKGEV
Download sequence
Identical sequences E6GJE7
WP_002399124.1.11459 WP_002399124.1.1595 WP_002399124.1.18475 WP_002399124.1.1948 WP_002399124.1.20674 WP_002399124.1.22059 WP_002399124.1.3016 WP_002399124.1.31326 WP_002399124.1.33685 WP_002399124.1.33798 WP_002399124.1.36880 WP_002399124.1.40757 WP_002399124.1.44501 WP_002399124.1.46113 WP_002399124.1.51046 WP_002399124.1.54795 WP_002399124.1.57163 WP_002399124.1.60579 WP_002399124.1.65210 WP_002399124.1.66845 WP_002399124.1.72635 WP_002399124.1.75949 WP_002399124.1.78447 WP_002399124.1.91092 WP_002399124.1.93642 WP_002399124.1.98652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]