SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002465800.1.32837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002465800.1.32837
Domain Number - Region: 27-73
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0432
Family Outer membrane lipoprotein 0.0059
Further Details:      
 
Domain Number - Region: 110-168
Classification Level Classification E-value
Superfamily Fibritin 0.0824
Family Fibritin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002465800.1.32837
Sequence length 192
Comment MULTISPECIES: hypothetical protein [Staphylococcus]; AA=GCF_000712915.1; RF=na; TAX=1448849; STAX=1292; NAME=Staphylococcus warneri Lyso 1 2011; strain=Lyso 1 2011; AL=Contig; RT=Major
Sequence
MKRYIIVIGASCLLAGCGSQNLAPLEDKTTKLRDDNHQLKLDIQQLNQDISNQKSTIAGL
QKDKENGKQTADNKKKEKNLKASSTYYDNVASAVDKYNNIKPDVTKNKGSQSIQKKLSTI
SSDLEDAYNTYNSDIDEDSMTSEDKQTKKNISSLNKDITSAFDKIETGYQEKDKKKIEKG
QQKLSTIQTDAN
Download sequence
Identical sequences A0A0U0DM63 A0A1U0JYK1 A0A1V4CRR4 A0A269XL22 A0A2K0DL85 L7WW13
gi|445059569|ref|YP_007384973.1| WP_002465800.1.25277 WP_002465800.1.25522 WP_002465800.1.32837 WP_002465800.1.40214 WP_002465800.1.44256 WP_002465800.1.46271 WP_002465800.1.4899 WP_002465800.1.54437 WP_002465800.1.66301 WP_002465800.1.66832 WP_002465800.1.70811 WP_002465800.1.77186 WP_002465800.1.78873 WP_002465800.1.85681 WP_002465800.1.89055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]