SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002466132.1.4937 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002466132.1.4937
Domain Number - Region: 60-90
Classification Level Classification E-value
Superfamily XPC-binding domain 0.00798
Family XPC-binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002466132.1.4937
Sequence length 94
Comment MULTISPECIES: hypothetical protein [Staphylococcus]; AA=GCF_001940625.1; RF=na; TAX=1282; STAX=1282; NAME=Staphylococcus epidermidis; strain=Col-B036; AL=Contig; RT=Major
Sequence
MENKFIPGVLLGAVIGGAATLADKSTRNSLKQSFSNVKEGKKSQKPSKVSSIKDEVMYWK
DVIEEIRRNNPELERSIKDAKDTFVNRKNERIGK
Download sequence
Identical sequences A0A0U0EIX1 A0A1Q9MLN3 A0A1U0JZ55 A0A1V1Z0A2 A0A1V4CN31 A0A269XG81 A0A2J6P0Y2 A0A2K0DM34 L7WVY8 U5UIY8
gi|445059273|ref|YP_007384677.1| gi|556590256|ref|YP_008758924.1| WP_002466132.1.14036 WP_002466132.1.15080 WP_002466132.1.25277 WP_002466132.1.25522 WP_002466132.1.32837 WP_002466132.1.40214 WP_002466132.1.46271 WP_002466132.1.4899 WP_002466132.1.4937 WP_002466132.1.54437 WP_002466132.1.66301 WP_002466132.1.66832 WP_002466132.1.70811 WP_002466132.1.77186 WP_002466132.1.78873 WP_002466132.1.85681 WP_002466132.1.89055 WP_002466132.1.94482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]