SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002467524.1.77186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002467524.1.77186
Domain Number 1 Region: 119-289
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.96e-47
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000574
Further Details:      
 
Weak hits

Sequence:  WP_002467524.1.77186
Domain Number - Region: 35-56
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.085
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002467524.1.77186
Sequence length 291
Comment MULTISPECIES: cell wall amidase [Staphylococcus]; AA=GCF_000736475.1; RF=na; TAX=1292; STAX=1292; NAME=Staphylococcus warneri; strain=NGS-ED-1001; AL=Contig; RT=Major
Sequence
MNKVNTWLTKHGLMNRLTLIVVICFVLFLILLFMFLNYNDEDNGTITITENAELRTGPNA
AYPVIYKIEKGDTFEKIDKSGKWIEVKNKAGDEKGWVAGWHTNLNIHAENSKKSAPLKGK
TIVLDPGHGGRDQGASSNTSSKSLEKVYTLKTAKELKTLLEKEGAHVKMTRSNDTYVSLD
DRNIKGDAFISIHNDSLDSPNANGVTVYWLQDNQEALAQTLSSSIQKKSLLTNKEARQQN
YQVLRQTNIPAVLLELGYISNPTDEGMVRDQLHRQVVEEAIVDGLKQYFSS
Download sequence
Identical sequences A0A0U0DN70 A0A1U0JZZ5 A0A1V4CRU5 A0A269XLQ2 A0A2K0DLJ1 L7WVP8
WP_002467524.1.15080 WP_002467524.1.25277 WP_002467524.1.25522 WP_002467524.1.32837 WP_002467524.1.44256 WP_002467524.1.46271 WP_002467524.1.66301 WP_002467524.1.66832 WP_002467524.1.70811 WP_002467524.1.77186 WP_002467524.1.78873 WP_002467524.1.85681 gi|445059474|ref|YP_007384878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]