SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002504770.1.32007 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002504770.1.32007
Domain Number - Region: 179-234
Classification Level Classification E-value
Superfamily Dhaf3308-like 0.00589
Family Dhaf3308-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002504770.1.32007
Sequence length 277
Comment MULTISPECIES: phage tail protein [Staphylococcus]; AA=GCF_001069075.1; RF=na; TAX=1282; STAX=1282; NAME=Staphylococcus epidermidis; strain=102_SEPI; AL=Scaffold; RT=Major
Sequence
MENKKVKIFNDHFEETLTDIPHLKFLEFEEEDLDRKSNQIEVNGSDGVLQGPMNFGPFNL
ILRFSYKGTDYKEYRLAKEKLRQLINRRDPYFVWHSDMPGKKYAVIPEGVSNENLTSQFG
LIEVTYSVYKGYAESLKDTSEFSWTDESWQFEQGVIGSDEVKYKHNIRYFKIFNGSKDTI
NPLLRHKLNINCTLTAPYGFEIVNLTTNDIFEYKKPLKKRNTVSIIGVHPYINNKRVGKD
TNYDFITLAPGWNEILIRGHNISNSPKTEFIFNYIYR
Download sequence
Identical sequences WP_002504770.1.31449 WP_002504770.1.32007 WP_002504770.1.36104 WP_002504770.1.37572 WP_002504770.1.38090 WP_002504770.1.46800 WP_002504770.1.52629 WP_002504770.1.60263 WP_002504770.1.64636 WP_002504770.1.89239 WP_002504770.1.95367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]