SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002505162.1.55323 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002505162.1.55323
Domain Number 1 Region: 160-204
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000216
Family GCC-box binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  WP_002505162.1.55323
Domain Number - Region: 63-118
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 0.0245
Family MHC antigen-recognition domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002505162.1.55323
Sequence length 206
Comment MULTISPECIES: AP2 domain-containing protein [Staphylococcus]; AA=GCF_001837535.1; RF=na; TAX=1715046; STAX=1715046; NAME=Staphylococcus sp. HMSC070A07; strain=HMSC070A07; AL=Scaffold; RT=Major
Sequence
MDIVGMQFNYLKVLEFYGRNKHKKKLYKCYCTRCGNEKIMIGTEVKNGYSKSCGCLNKVS
HSKKHGMTGTLIYNKWKGMKQRCYNSNYDFYSAYGGRGIKVCDEWKDDFMQFYKDMGDVP
FEGAELDRINNDDDYKPSNCRWVSHEENANNRRKYHNKTGYTGVTYKPHLNKYQAQLYKN
KKFIYLGVYETAEEAHLAYKKAKNEY
Download sequence
Identical sequences A0A2G7KHI3
WP_002505162.1.13993 WP_002505162.1.29900 WP_002505162.1.55323 WP_002505162.1.62056 WP_002505162.1.85545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]