SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002515023.1.57145 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002515023.1.57145
Domain Number - Region: 61-114
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.00602
Family Coiled-coil dimerization domain from cortexillin I 0.0076
Further Details:      
 
Domain Number - Region: 137-194
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0201
Family FMN-linked oxidoreductases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002515023.1.57145
Sequence length 250
Comment MULTISPECIES: hypothetical protein [Propionibacteriaceae]; AA=GCF_001469635.1; RF=na; TAX=1747; STAX=1747; NAME=Cutibacterium acnes; strain=PA_12_1_R1; AL=Chromosome; RT=Major
Sequence
MPDHHDRREWAENHWRKIGKDLASVSTGQILVAIMLCLCSFMVVTQVRSRHDQDAYSTMS
RADLVTMLDSLSDSSRQLDSEIADLRATTRDLQSGADSRKVARQEAEERLTRMKILAGTI
PVHGPGIKITIDDPEDKVTSDMVLDAVEEMRDAGAEAMVLNNKVRIVADTWFAASPDGLQ
VSGTTVTRPYTLTIIGQPHALKEGAKFRGGLVSQMESDKVGASVEVTTSRDLTITAVARP
QPMTHATPVR
Download sequence
Identical sequences A0A1W9TSW7 A0A2B7J2R9
WP_002515023.1.102131 WP_002515023.1.1505 WP_002515023.1.23000 WP_002515023.1.27635 WP_002515023.1.29850 WP_002515023.1.30003 WP_002515023.1.31800 WP_002515023.1.32488 WP_002515023.1.34331 WP_002515023.1.41264 WP_002515023.1.42227 WP_002515023.1.48475 WP_002515023.1.49524 WP_002515023.1.50378 WP_002515023.1.54292 WP_002515023.1.56441 WP_002515023.1.56826 WP_002515023.1.57145 WP_002515023.1.58125 WP_002515023.1.59962 WP_002515023.1.60649 WP_002515023.1.66916 WP_002515023.1.70496 WP_002515023.1.7197 WP_002515023.1.73086 WP_002515023.1.74916 WP_002515023.1.7599 WP_002515023.1.76841 WP_002515023.1.83430 WP_002515023.1.86359 WP_002515023.1.90730 WP_002515023.1.91146 WP_002515023.1.98214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]