SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002560978.1.35582 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002560978.1.35582
Domain Number - Region: 101-192
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00414
Family DBL homology domain (DH-domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002560978.1.35582
Sequence length 209
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000944095.1; RF=na; TAX=817; STAX=817; NAME=Bacteroides fragilis; strain=2d2A; AL=Contig; RT=Major
Sequence
MRTRITMIICLCLLFAGRASAQWVVSDPGNLAQGIINASKNIIHTSKTATNMVSNFQETV
KIYQQGKKYYDALKSVNNLVKDARKVQQTILMVGDITDIYVNSFQRMLRDGNFRPEELSA
IAFGYTKLLEESNEVLTELKNVVNITTLSMTDKERMDVVERCYSKMKRYRNLVSYYTNKN
ISVSYLRAKKKNDLDRIMGLYGNMNERYW
Download sequence
Identical sequences A0A016EID7 A0A096AFX7 A0A0E2AVL0 A0A0J9DI76 A0A0M1W6P8 A0A174U3D7 A0A1C6L5C4 A0A1E9BQG6 A0A1G6G5K1 A0A1H4BU66 A0A2J6A586 C6ITZ9 C7XB93 D1W4B2 F7LRP0 G1VEW2 I9RKJ3 I9V6D9 U6RJE0
WP_002560978.1.10487 WP_002560978.1.11335 WP_002560978.1.2011 WP_002560978.1.21107 WP_002560978.1.22050 WP_002560978.1.23698 WP_002560978.1.26934 WP_002560978.1.28290 WP_002560978.1.32651 WP_002560978.1.34692 WP_002560978.1.35533 WP_002560978.1.35582 WP_002560978.1.35818 WP_002560978.1.40665 WP_002560978.1.42362 WP_002560978.1.43770 WP_002560978.1.44936 WP_002560978.1.456 WP_002560978.1.46679 WP_002560978.1.49420 WP_002560978.1.50677 WP_002560978.1.5142 WP_002560978.1.51489 WP_002560978.1.63108 WP_002560978.1.66858 WP_002560978.1.66941 WP_002560978.1.69826 WP_002560978.1.73642 WP_002560978.1.73957 WP_002560978.1.76253 WP_002560978.1.79035 WP_002560978.1.87144 WP_002560978.1.89499 WP_002560978.1.89819 WP_002560978.1.91045 WP_002560978.1.93978 WP_002560978.1.95195 WP_002560978.1.96419 WP_002560978.1.97964 WP_002560978.1.98975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]