SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002581789.1.34338 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002581789.1.34338
Domain Number 1 Region: 3-174
Classification Level Classification E-value
Superfamily CheY-like 8.15e-39
Family CheY-related 0.00059
Further Details:      
 
Weak hits

Sequence:  WP_002581789.1.34338
Domain Number - Region: 186-221
Classification Level Classification E-value
Superfamily Fibritin 0.0141
Family Fibritin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002581789.1.34338
Sequence length 223
Comment DNA-binding response regulator [Clostridium butyricum]; AA=GCF_000371625.1; RF=na; TAX=997898; STAX=1492; NAME=Clostridium butyricum 60E.3; strain=60E.3; AL=Scaffold; RT=Major
Sequence
MSLNILIAEDDNLFRSLVCDIITDQGYIPIEARNGQEAIDKFFDLGNIDLVILDVMMPVY
DGFEVLKEIREHSDIPIIMLTALGDEKHELLGFNKGADEYIGKPFSYEVFIARLNNIAKK
IKHDTEKEITYGKIIINQSNHKVISDGLEIKLNHKEYTLLIYFIKNSGKVLTREQILNSV
WGYDFDGDIRTIDTHIKTLRAKLKTEGTYIKTVRGCGYMIEVK
Download sequence
Identical sequences R0A5U5
WP_002581789.1.34338 WP_002581789.1.5913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]