SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002585820.1.40988 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002585820.1.40988
Domain Number 1 Region: 3-81
Classification Level Classification E-value
Superfamily Homeodomain-like 2.19e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0075
Further Details:      
 
Weak hits

Sequence:  WP_002585820.1.40988
Domain Number - Region: 135-161
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0167
Family Retrovirus capsid protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002585820.1.40988
Sequence length 210
Comment TetR family transcriptional regulator [[Clostridium] clostridioforme]; AA=GCF_000371585.1; RF=na; TAX=999404; STAX=1531; NAME=[Clostridium] clostridioforme 90A3; strain=90A3; AL=Scaffold; RT=Major
Sequence
MPTQRFLKLKEEKRQAILEAAVHEFSRVPYSSASINQIIKEADISRGSFYTYFEDKDDLM
RYMLRGFRDNCQERIFRTLKEQEGNPFETALKLLEAVVDEDHGGLGYKMYRNMLSDLSVV
DQNHLFGIKGFLLQDESYREFVQKLYEGIDRERYPIDEENLAYLVDMAMIIIIRAVTLYY
KNVVDREKLLEVSKKEMLILEYGVCRNIGS
Download sequence
Identical sequences R0BN93
WP_002585820.1.100967 WP_002585820.1.16167 WP_002585820.1.17088 WP_002585820.1.40988 WP_002585820.1.55193 WP_002585820.1.74441 WP_002585820.1.81751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]