SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002759794.1.51494 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002759794.1.51494
Domain Number - Region: 14-45
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.00262
Family Surp module (SWAP domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002759794.1.51494
Sequence length 48
Comment PF06114 domain protein [Leptospira borgpetersenii]; AA=GCF_001569485.1; RF=na; TAX=174; STAX=174; NAME=Leptospira borgpetersenii; strain=56613; AL=Contig; RT=Major
Sequence
MHHLGESIEQNYYYEYNQNLIENQADDFAFEFLMPKKNIRSYLKNILE
Download sequence
Identical sequences M3H4Y8 M6BNG6
WP_002759794.1.14 WP_002759794.1.15257 WP_002759794.1.18256 WP_002759794.1.30409 WP_002759794.1.38848 WP_002759794.1.421 WP_002759794.1.48790 WP_002759794.1.51494 WP_002759794.1.51921 WP_002759794.1.55252 WP_002759794.1.75198 WP_002759794.1.75262 WP_002759794.1.76100 WP_002759794.1.84953 WP_002759794.1.87468 WP_002759794.1.95176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]