SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002806151.1.44444 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002806151.1.44444
Domain Number - Region: 42-99
Classification Level Classification E-value
Superfamily MIR domain 0.0366
Family MIR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002806151.1.44444
Sequence length 103
Comment hypothetical protein [Xanthomonas fragariae]; AA=GCF_900183995.1; RF=na; TAX=48664; STAX=48664; NAME=Xanthomonas fragariae; AL=Complete Genome; RT=Major
Sequence
MSKRRIALIILLIAGLAACSADGPAPTEREHAFLQYVKDNGSDDARIEDFKSGKCTKAQG
APSYVCDVSAEVTAMGRKFGHEMDGVYTFSEVGGVWKVTGRIQ
Download sequence
Identical sequences A0A1Y6HHW4
WP_002806151.1.12554 WP_002806151.1.44444 WP_002806151.1.74218 WP_002806151.1.90229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]