SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002808666.1.77844 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002808666.1.77844
Domain Number - Region: 10-46
Classification Level Classification E-value
Superfamily Myosin phosphatase inhibitor 17kDa protein, CPI-17 0.0392
Family Myosin phosphatase inhibitor 17kDa protein, CPI-17 0.0078
Further Details:      
 
Domain Number - Region: 68-99
Classification Level Classification E-value
Superfamily PAH2 domain 0.0968
Family PAH2 domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002808666.1.77844
Sequence length 147
Comment hypothetical protein [Nitrosococcus oceani]; AA=GCF_000155655.1; RF=na; TAX=473788; STAX=1229; NAME=Nitrosococcus oceani AFC27; strain=AFC27; AL=Scaffold; RT=Major
Sequence
MTHPNEDYYAWTQETIEKLRQGRLNEVNTEVLIEELEDMGRSERRGIESRLSVLLMHLLK
WRYQPDRRGHSGRATIKEQRLRVTRLLKDNPSLQSQFSTINAEAYESAVLRAVAETNKPE
TTFPSTFEQTGWPLEQVLDRDFYPNNV
Download sequence
Identical sequences A0A0E2Z990 Q3JD17
gi|77164284|ref|YP_342809.1| 323261.Noc_0766 WP_002808666.1.20919 WP_002808666.1.77844 WP_002808666.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]