SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002822804.1.84904 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002822804.1.84904
Domain Number - Region: 58-131
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000366
Family Apolipoprotein A-I 0.0069
Further Details:      
 
Domain Number - Region: 18-72
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0719
Family Oxygen-evolving enhancer protein 3, 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002822804.1.84904
Sequence length 161
Comment hypothetical protein [Oenococcus oeni]; AA=GCF_001869165.1; RF=na; TAX=1247; STAX=1247; NAME=Oenococcus oeni; strain=AWRIB791; AL=Contig; RT=Major
Sequence
MAKGLVAGILATAAAYVAFKALPQEKQDELIKKAKDAGNKLKDLGYDAAYAGADLAGDLS
EKAKNKVGEFDEQIKDSKYADTYQGVKDKAADVIDQASPYVEKAKDKASDLVDKASPYVD
KAKDTIDDLRRRFSKEDIDLEEDDALKDDLTKPDSDEKEDK
Download sequence
Identical sequences A0A1S2S371
WP_002822804.1.18575 WP_002822804.1.18702 WP_002822804.1.21424 WP_002822804.1.25125 WP_002822804.1.3047 WP_002822804.1.31454 WP_002822804.1.39934 WP_002822804.1.4018 WP_002822804.1.46962 WP_002822804.1.50041 WP_002822804.1.50085 WP_002822804.1.60018 WP_002822804.1.64319 WP_002822804.1.66856 WP_002822804.1.68520 WP_002822804.1.72553 WP_002822804.1.79307 WP_002822804.1.80623 WP_002822804.1.80659 WP_002822804.1.82516 WP_002822804.1.84904 WP_002822804.1.85186 WP_002822804.1.85349 WP_002822804.1.85535 WP_002822804.1.90030 WP_002822804.1.92804 WP_002822804.1.94063 WP_002822804.1.94761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]