SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002849046.1.74407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002849046.1.74407
Domain Number - Region: 69-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Hairpin loop containing domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002849046.1.74407
Sequence length 123
Comment zinc/iron-chelating domain-containing protein [Campylobacter fetus]; AA=GCF_001686885.1; RF=na; TAX=32020; STAX=196; NAME=Campylobacter fetus subsp. venerealis; strain=01/165; AL=Complete Genome; RT=Major
Sequence
MLKEFGFDYCFDSSKCEVCGAKCCTGDSGYIWISEAEMESLSSHLKLSLPEFKKLFTYRV
GVRFSLKEKEYNGAYACLFFDENNKNCSVYEFRPKQCRTFPFWDYFKKHFNELEKECIGV
ERL
Download sequence
Identical sequences A0A0E1GHF2 A0RNN1 W0DAA3
360106.CFF8240_0638 gi|118475676|ref|YP_891814.1| WP_002849046.1.1289 WP_002849046.1.1469 WP_002849046.1.16919 WP_002849046.1.17016 WP_002849046.1.36062 WP_002849046.1.38168 WP_002849046.1.39057 WP_002849046.1.40084 WP_002849046.1.41035 WP_002849046.1.42553 WP_002849046.1.42882 WP_002849046.1.44411 WP_002849046.1.46075 WP_002849046.1.46714 WP_002849046.1.48558 WP_002849046.1.51765 WP_002849046.1.5603 WP_002849046.1.59303 WP_002849046.1.60351 WP_002849046.1.62614 WP_002849046.1.63275 WP_002849046.1.68475 WP_002849046.1.71429 WP_002849046.1.74407 WP_002849046.1.77129 WP_002849046.1.77394 WP_002849046.1.81562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]