SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002849132.1.17016 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002849132.1.17016
Domain Number 1 Region: 3-218
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.28e-62
Family Pseudouridine synthase II TruB 0.0000687
Further Details:      
 
Weak hits

Sequence:  WP_002849132.1.17016
Domain Number - Region: 235-258
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.012
Family Supernatant protein factor (SPF), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002849132.1.17016
Sequence length 278
Comment tRNA pseudouridine(55) synthase TruB [Campylobacter fetus]; AA=GCF_000512745.2; RF=na; TAX=1273266; STAX=196; NAME=Campylobacter fetus subsp. venerealis cfvi03/293; strain=cfvi03/293; AL=Complete Genome; RT=Major
Sequence
MKDNRLFVANKPSGISSNHFLSRLKRKYGVKKAGFSGTLDPFANGALIIAFGAYTKLFNY
LEKTPKTYVATLWLGANSQSLDNENIRSVCKLKPFAMDSIDIVMKDLQGKITYVPPKFSA
KKIDGKRAYALARNGEEFEMKSSVMEIFNVKLIHYCHPFLSFEISLSEGAYVRSWANLFA
KRLGVDGTLSALRRVSEGRFKFENEKALDPLEFLNLAQNSYLGNEDNIKDGKKLDINEFQ
IKTDGTYYLIFDNFFSIIKIENGAVSYCLNKVEYAYTN
Download sequence
Identical sequences A0A0E1GHL9 A0RNV7 W0D9N8
WP_002849132.1.1289 WP_002849132.1.1469 WP_002849132.1.16919 WP_002849132.1.17016 WP_002849132.1.36062 WP_002849132.1.38168 WP_002849132.1.39057 WP_002849132.1.41035 WP_002849132.1.42553 WP_002849132.1.42882 WP_002849132.1.44411 WP_002849132.1.46075 WP_002849132.1.46714 WP_002849132.1.48558 WP_002849132.1.51765 WP_002849132.1.5603 WP_002849132.1.59303 WP_002849132.1.60351 WP_002849132.1.62614 WP_002849132.1.63275 WP_002849132.1.68475 WP_002849132.1.71429 WP_002849132.1.74407 WP_002849132.1.77129 WP_002849132.1.77394 WP_002849132.1.81562 gi|118474138|ref|YP_891890.1| 360106.CFF8240_0715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]