SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002892812.1.82138 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002892812.1.82138
Domain Number - Region: 66-112
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0119
Family IP3 receptor type 1 binding core, domain 2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002892812.1.82138
Sequence length 158
Comment hypothetical protein [Campylobacter jejuni]; AA=GCF_001912845.1; RF=na; TAX=197; STAX=197; NAME=Campylobacter jejuni; strain=BCW_6902; AL=Contig; RT=Major
Sequence
MKHCLALCFIFFLCACSVKNQNFSSQSLMVLIASPMIKINDAAFLKKENNALNLEVYKLG
QAFFELKIKDKICINAVCYDKKVFNQKFFKNVYYDDILSDILKANALWQGRNLEKTDCGF
EQNLKAKNYEIFYQVCDNKVSFFDKISHTKIILTHIQN
Download sequence
Identical sequences WP_002892812.1.18713 WP_002892812.1.33225 WP_002892812.1.77538 WP_002892812.1.78209 WP_002892812.1.78370 WP_002892812.1.82138 WP_002892812.1.92680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]