SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002899315.1.61064 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002899315.1.61064
Domain Number 1 Region: 61-203
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000451
Family MoCo biosynthesis proteins 0.037
Further Details:      
 
Weak hits

Sequence:  WP_002899315.1.61064
Domain Number - Region: 195-243
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0458
Family Surp module (SWAP domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002899315.1.61064
Sequence length 247
Comment hypothetical protein [Campylobacter jejuni]; AA=GCF_001912925.1; RF=na; TAX=197; STAX=197; NAME=Campylobacter jejuni; strain=BCW_5155; AL=Contig; RT=Major
Sequence
MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDKTLIGCDTIRAVFTKD
FKESYETLNANELLKRVIKLKQDFDPIVVITGGEPLIHYENPEFIEFIQMLLKNKFEIHF
ESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKALKAFKNYAKDSFYKFVLD
ANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIAEFCIKNGYNYSDRIHIRL
WNDKEGV
Download sequence
Identical sequences WP_002899315.1.10197 WP_002899315.1.20237 WP_002899315.1.20333 WP_002899315.1.30486 WP_002899315.1.30793 WP_002899315.1.32759 WP_002899315.1.33256 WP_002899315.1.35427 WP_002899315.1.35997 WP_002899315.1.41175 WP_002899315.1.41544 WP_002899315.1.41619 WP_002899315.1.55481 WP_002899315.1.57361 WP_002899315.1.58149 WP_002899315.1.60034 WP_002899315.1.61064 WP_002899315.1.66841 WP_002899315.1.67847 WP_002899315.1.73767 WP_002899315.1.74803 WP_002899315.1.78032 WP_002899315.1.85240 WP_002899315.1.86570 WP_002899315.1.88643 WP_002899315.1.893 WP_002899315.1.89687 WP_002899315.1.9776 WP_002899315.1.98367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]