SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002934847.1.29773 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002934847.1.29773
Domain Number 1 Region: 61-203
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000765
Family MoCo biosynthesis proteins 0.04
Further Details:      
 
Weak hits

Sequence:  WP_002934847.1.29773
Domain Number - Region: 195-243
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0458
Family Surp module (SWAP domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002934847.1.29773
Sequence length 247
Comment MULTISPECIES: hypothetical protein [Campylobacter]; AA=GCF_001765055.1; RF=na; TAX=197; STAX=197; NAME=Campylobacter jejuni; strain=BCW_5128; AL=Scaffold; RT=Major
Sequence
MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDKTLIGCDTIRAVFTKD
FKESYETLNANELLKRVIKLKQDFDPIVVITGGEPLIHYENPEFTEFIQMLLKNKFEIHF
ESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKALKAFKNYAKDSFYKFVLD
ANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIAEFCIKNGYNYSDRIHIRL
WNDKEGV
Download sequence
Identical sequences WP_002934847.1.101513 WP_002934847.1.13689 WP_002934847.1.13900 WP_002934847.1.16796 WP_002934847.1.25369 WP_002934847.1.29773 WP_002934847.1.39429 WP_002934847.1.44249 WP_002934847.1.50400 WP_002934847.1.51026 WP_002934847.1.57437 WP_002934847.1.57498 WP_002934847.1.59383 WP_002934847.1.69860 WP_002934847.1.79025 WP_002934847.1.79430 WP_002934847.1.80202 WP_002934847.1.82083 WP_002934847.1.82126 WP_002934847.1.85309 WP_002934847.1.85714 WP_002934847.1.87184 WP_002934847.1.94660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]