SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003027282.1.47286 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003027282.1.47286
Domain Number - Region: 30-115
Classification Level Classification E-value
Superfamily VPS9 domain 0.0114
Family VPS9 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003027282.1.47286
Sequence length 123
Comment hypothetical protein [Francisella tularensis]; AA=GCF_000742095.1; RF=na; TAX=263; STAX=263; NAME=Francisella tularensis; strain=Larsen; AL=Scaffold; RT=Major
Sequence
MSSLFLLLESMRFSPVKANSRILELGHKIRLGRPSTVTSHMMMSQFRNKAITRSNQKELE
YTINDFILKIRPAEISRFFSDLEGVLMTKIAPLIQYNYKYLGKSNELLFFFKLRFSHLCN
LLN
Download sequence
Identical sequences WP_003027282.1.17073 WP_003027282.1.17471 WP_003027282.1.26192 WP_003027282.1.26690 WP_003027282.1.39861 WP_003027282.1.42944 WP_003027282.1.47286 WP_003027282.1.53326 WP_003027282.1.5563 WP_003027282.1.66463 WP_003027282.1.78037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]