SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003159111.1.86386 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003159111.1.86386
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.71e-61
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.44e-43
Family PA2201 C-terminal domain-like 0.0000000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003159111.1.86386
Sequence length 294
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_000796125.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=AZPAE14403; AL=Scaffold; RT=Major
Sequence
MHAFPLTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIRALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences WP_003159111.1.12302 WP_003159111.1.14640 WP_003159111.1.16279 WP_003159111.1.20929 WP_003159111.1.21302 WP_003159111.1.25033 WP_003159111.1.27939 WP_003159111.1.30000 WP_003159111.1.31045 WP_003159111.1.31565 WP_003159111.1.31939 WP_003159111.1.34625 WP_003159111.1.35325 WP_003159111.1.36781 WP_003159111.1.38003 WP_003159111.1.3998 WP_003159111.1.40541 WP_003159111.1.41291 WP_003159111.1.41618 WP_003159111.1.41625 WP_003159111.1.43673 WP_003159111.1.46623 WP_003159111.1.47158 WP_003159111.1.5235 WP_003159111.1.53169 WP_003159111.1.53427 WP_003159111.1.54140 WP_003159111.1.56768 WP_003159111.1.57480 WP_003159111.1.59870 WP_003159111.1.65227 WP_003159111.1.69599 WP_003159111.1.70991 WP_003159111.1.74175 WP_003159111.1.74629 WP_003159111.1.79431 WP_003159111.1.79862 WP_003159111.1.81591 WP_003159111.1.81728 WP_003159111.1.84439 WP_003159111.1.86386 WP_003159111.1.86947 WP_003159111.1.88679 WP_003159111.1.90940 WP_003159111.1.91563 WP_003159111.1.92587 WP_003159111.1.92894 WP_003159111.1.93148 WP_003159111.1.97877 WP_003159111.1.98926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]