SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003181044.1.10695 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003181044.1.10695
Domain Number - Region: 8-64
Classification Level Classification E-value
Superfamily HR1 repeat 0.0188
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003181044.1.10695
Sequence length 65
Comment MULTISPECIES: acid-soluble spore protein [Bacillus]; AA=GCF_001896025.1; RF=na; TAX=1856406; STAX=1856406; NAME=Bacillus sp. H15-1; strain=H15-1; AL=Complete Genome; RT=Major
Sequence
MARTNKLLVPGAEQVLDQFKYEIAQEFGVQLGSDSVARSNGSVGGEMTKRLVQQAQAQLN
GHNDK
Download sequence
Identical sequences A0A1Y0YNJ9 Q65KL2 T5HRW5
WP_003181044.1.10695 WP_003181044.1.12567 WP_003181044.1.1290 WP_003181044.1.20727 WP_003181044.1.21456 WP_003181044.1.22930 WP_003181044.1.27377 WP_003181044.1.27603 WP_003181044.1.27836 WP_003181044.1.30581 WP_003181044.1.31090 WP_003181044.1.31877 WP_003181044.1.34504 WP_003181044.1.34863 WP_003181044.1.34956 WP_003181044.1.35726 WP_003181044.1.35764 WP_003181044.1.42641 WP_003181044.1.46361 WP_003181044.1.46635 WP_003181044.1.47006 WP_003181044.1.48016 WP_003181044.1.50447 WP_003181044.1.54544 WP_003181044.1.55910 WP_003181044.1.57471 WP_003181044.1.62441 WP_003181044.1.62618 WP_003181044.1.64701 WP_003181044.1.70162 WP_003181044.1.719 WP_003181044.1.71919 WP_003181044.1.7403 WP_003181044.1.74244 WP_003181044.1.8120 WP_003181044.1.82128 WP_003181044.1.85389 WP_003181044.1.8660 WP_003181044.1.86740 WP_003181044.1.86759 WP_003181044.1.94809 WP_003181044.1.9500 WP_003181044.1.95031 WP_003181044.1.9558 WP_003181044.1.96953 WP_003181044.1.98374 WP_003181044.1.99505 279010.BL03629 gi|404488777|ref|YP_006712883.1| gi|52079894|ref|YP_078685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]