SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003193504.1.68186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003193504.1.68186
Domain Number - Region: 12-52
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.0361
Family eIF2alpha middle domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003193504.1.68186
Sequence length 171
Comment hypothetical protein [Bacillus mycoides]; AA=GCF_000003925.1; RF=na; TAX=526997; STAX=1405; NAME=Bacillus mycoides DSM 2048; strain=DSM 2048; AL=Chromosome; RT=Major
Sequence
MKAEKEAQLQAEREMKKKREEWANHHPAEAWLQDVSGSFGKKWDGLEKGTRWLGMLGTNY
PALKRLSDEALVLEGFIGKAGSAISGAAIGVIKLVYLGAELIEWGYNSIHGVETEQWKLD
DLHATWQGVKKLTEYGIVGSITTTAPYLSDFLNNPALTDKIPVLDNLARTY
Download sequence
Identical sequences A0A0B5S702
WP_003193504.1.20881 WP_003193504.1.68186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]