SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003232560.1.5726 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003232560.1.5726
Domain Number 1 Region: 166-275
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.04e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 
Weak hits

Sequence:  WP_003232560.1.5726
Domain Number - Region: 86-139
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0425
Family Glutathione S-transferase (GST), C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003232560.1.5726
Sequence length 277
Comment MULTISPECIES: RsbT co-antagonist protein RsbRB [Bacillus]; AA=GCF_000344745.1; RF=na; TAX=1147161; STAX=1423; NAME=Bacillus subtilis subsp. subtilis 6051-HGW; strain=6051-HGW; AL=Complete Genome; RT=Major
Sequence
MKLNEKLYAFFSEHVEQMAEEWIETMEESDPNSLYALHNATVTEELKEQDREFYRHLNYM
YVLPEKQFLEEFQEWVIELTNDQKHLDTPVQYVIREFMRNRRLYTKYFEKFAEENESAFE
PGEKQKWADLIVKVFDFTIYTFVDHAEMNAKQQLNAQREMILELSSPVITLSKSTALLPL
VGDIDTERAKFILENTLQACAKRRVEHLLIDLSGVVVVDTMVAHQIFKLIEALNLIGVRS
TLSGIRPEIAQTAVQLGIDFSNITIKTNLAQALNYHQ
Download sequence
Identical sequences A0A063XAC1 A0A0T8PKZ7 A0A125UGQ2 A0A199WHT8 A0A1J5XQS1 A0A1Y0WKW5 D4FVP2 G4EX95 L8AK74 M4KU92 O34860 U1YWW3
gi|16078385|ref|NP_389203.1| gi|449094017|ref|YP_007426508.1| 224308.BSU13200 NP_389203.1.22788 WP_003232560.1.100042 WP_003232560.1.101301 WP_003232560.1.11088 WP_003232560.1.11231 WP_003232560.1.11257 WP_003232560.1.1140 WP_003232560.1.11581 WP_003232560.1.12644 WP_003232560.1.12759 WP_003232560.1.1358 WP_003232560.1.15902 WP_003232560.1.16291 WP_003232560.1.18944 WP_003232560.1.19261 WP_003232560.1.20099 WP_003232560.1.20502 WP_003232560.1.21045 WP_003232560.1.22408 WP_003232560.1.23108 WP_003232560.1.2546 WP_003232560.1.25531 WP_003232560.1.27372 WP_003232560.1.27612 WP_003232560.1.27660 WP_003232560.1.2914 WP_003232560.1.31028 WP_003232560.1.31100 WP_003232560.1.31260 WP_003232560.1.32025 WP_003232560.1.32219 WP_003232560.1.32420 WP_003232560.1.32693 WP_003232560.1.32861 WP_003232560.1.33285 WP_003232560.1.33846 WP_003232560.1.34621 WP_003232560.1.36189 WP_003232560.1.37074 WP_003232560.1.39562 WP_003232560.1.39605 WP_003232560.1.40859 WP_003232560.1.42762 WP_003232560.1.44140 WP_003232560.1.44184 WP_003232560.1.45019 WP_003232560.1.47157 WP_003232560.1.51783 WP_003232560.1.5262 WP_003232560.1.52847 WP_003232560.1.54949 WP_003232560.1.55792 WP_003232560.1.56274 WP_003232560.1.56411 WP_003232560.1.57184 WP_003232560.1.57201 WP_003232560.1.5726 WP_003232560.1.57513 WP_003232560.1.6139 WP_003232560.1.63795 WP_003232560.1.64889 WP_003232560.1.6517 WP_003232560.1.65188 WP_003232560.1.65223 WP_003232560.1.65841 WP_003232560.1.67028 WP_003232560.1.69439 WP_003232560.1.71402 WP_003232560.1.7159 WP_003232560.1.7186 WP_003232560.1.71916 WP_003232560.1.72152 WP_003232560.1.72516 WP_003232560.1.72999 WP_003232560.1.76977 WP_003232560.1.77994 WP_003232560.1.78686 WP_003232560.1.78811 WP_003232560.1.79046 WP_003232560.1.79288 WP_003232560.1.79712 WP_003232560.1.79987 WP_003232560.1.80832 WP_003232560.1.81116 WP_003232560.1.81747 WP_003232560.1.82722 WP_003232560.1.82789 WP_003232560.1.84183 WP_003232560.1.84434 WP_003232560.1.84556 WP_003232560.1.87300 WP_003232560.1.88042 WP_003232560.1.88591 WP_003232560.1.89000 WP_003232560.1.89821 WP_003232560.1.90830 WP_003232560.1.91133 WP_003232560.1.9164 WP_003232560.1.91723 WP_003232560.1.93073 WP_003232560.1.93420 WP_003232560.1.94199 WP_003232560.1.96043 WP_003232560.1.979 WP_003232560.1.99091 WP_003232560.1.99399 gi|560128394|ref|YP_008829535.1| gi|402775556|ref|YP_006629500.1| gi|384175045|ref|YP_005556430.1| gi|428278891|ref|YP_005560626.1| gi|321315072|ref|YP_004207359.1| gi|430756956|ref|YP_007209980.1| gi|470161492|ref|YP_007533267.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]