SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003313786.1.46407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003313786.1.46407
Domain Number - Region: 17-59
Classification Level Classification E-value
Superfamily KA1-like 0.036
Family Ssp2 C-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003313786.1.46407
Sequence length 102
Comment hypothetical protein [Pseudomonas syringae]; AA=GCF_000988395.1; RF=na; TAX=1324932; STAX=317; NAME=Pseudomonas syringae pv. syringae HS191; strain=HS191; AL=Complete Genome; RT=Major
Sequence
MNYQEFIGHAQAGRVDELNLISIEGGIYLLDVRMNGTSVMLKDPAGKTLHLRSVEHARDL
LKEIPVVPFYLVHCVVHDELCGMPVNDRSEMRLPISFHSSWS
Download sequence
Identical sequences A0A0F7A1B5 A0A0P9SNB4 F3FC58 F3G3K5
WP_003313786.1.15686 WP_003313786.1.24052 WP_003313786.1.27030 WP_003313786.1.46407 WP_003313786.1.47305 WP_003313786.1.54758 WP_003313786.1.56854 WP_003313786.1.80483 WP_003313786.1.80590 WP_003313786.1.85119 WP_003313786.1.91016 WP_003313786.1.98823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]