SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003327102.1.7305 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003327102.1.7305
Domain Number - Region: 48-78
Classification Level Classification E-value
Superfamily BRK domain-like 0.014
Family BRK domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003327102.1.7305
Sequence length 78
Comment MULTISPECIES: hypothetical protein [Bacillus subtilis group]; AA=GCF_000743235.1; RF=na; TAX=1495315; STAX=1423; NAME=Bacillus subtilis subsp. niger; strain=PCI 246; AL=Scaffold; RT=Major
Sequence
MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSHCGKCMESLFALVNGEVVTGSD
AAELVENIYTFLEENPMF
Download sequence
Identical sequences A0A080UGS1 A0A0H3E7A5 A0A150L194
gi|311069713|ref|YP_003974636.1| WP_003327102.1.100936 WP_003327102.1.10353 WP_003327102.1.15971 WP_003327102.1.16994 WP_003327102.1.30485 WP_003327102.1.32777 WP_003327102.1.39473 WP_003327102.1.39900 WP_003327102.1.40255 WP_003327102.1.45236 WP_003327102.1.48649 WP_003327102.1.52389 WP_003327102.1.53439 WP_003327102.1.59507 WP_003327102.1.62747 WP_003327102.1.68581 WP_003327102.1.69262 WP_003327102.1.70004 WP_003327102.1.72589 WP_003327102.1.72801 WP_003327102.1.7305 WP_003327102.1.7508 WP_003327102.1.79721 WP_003327102.1.94463 WP_003327102.1.96443 WP_003327102.1.99425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]