SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003398225.1.12655 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003398225.1.12655
Domain Number - Region: 64-118
Classification Level Classification E-value
Superfamily Fibritin 0.0165
Family Fibritin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003398225.1.12655
Sequence length 123
Comment septum formation initiator [Anoxybacillus flavithermus]; AA=GCF_000353425.1; RF=na; TAX=1297581; STAX=33934; NAME=Anoxybacillus flavithermus AK1; strain=AK1; AL=Contig; RT=Major
Sequence
MGAPQRNRVQKIQTSYVIQQEKQEHKKARRRKKIFIRFSMLATVALAASSLFLYLMMAQS
STIDKQIKTKEQLEEKLSTLQKDEKRLQEEIKKLNDDQYIAELARKQYFLSKEGEIIFIT
PDD
Download sequence
Identical sequences M8CUU6
WP_003398225.1.12655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]