SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003400777.1.95223 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003400777.1.95223
Domain Number - Region: 84-143
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0392
Family eIF-2-alpha, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003400777.1.95223
Sequence length 237
Comment radical SAM protein [Clostridium botulinum]; AA=GCF_001574095.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=SU1891; AL=Contig; RT=Major
Sequence
MKVRYLIKFSKEGNIKFVSHLDLQRTLQRNFKRSGLPVEYSKGFNPHIIMSLAQPLAVGL
YSKGEYLDVSFIEEEDEKIIVDKLNSTAPSGIKYFKAVKLKEGTNKKVFKSMAAVAAAKY
IIQIKYKNTENLEDELKTLLNMDNWDIIKKGKKGSKNVNIKPMIKNIDYSIESNLLKINV
LVSCGSIQNLSADLLAQFIKENTSDTKENSFVDIERQEIYGEYKNKLVALSDYAMYV
Download sequence
Identical sequences A0A2I4M4E1 B1ILZ0 C1FVX0
WP_003400777.1.101508 WP_003400777.1.14863 WP_003400777.1.16999 WP_003400777.1.21789 WP_003400777.1.27859 WP_003400777.1.29491 WP_003400777.1.32894 WP_003400777.1.36253 WP_003400777.1.43055 WP_003400777.1.44945 WP_003400777.1.45672 WP_003400777.1.46996 WP_003400777.1.51228 WP_003400777.1.52741 WP_003400777.1.53136 WP_003400777.1.57050 WP_003400777.1.67940 WP_003400777.1.69692 WP_003400777.1.70928 WP_003400777.1.76938 WP_003400777.1.77051 WP_003400777.1.79827 WP_003400777.1.87856 WP_003400777.1.90975 WP_003400777.1.94833 WP_003400777.1.95223 gi|170756346|ref|YP_001782624.1| gi|226950415|ref|YP_002805506.1| 498213.CLD_1553 536232.CLM_3387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]