SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003419843.1.19627 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003419843.1.19627
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.0049
Family eIF2alpha middle domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003419843.1.19627
Sequence length 44
Comment hypothetical protein [Clostridioides difficile]; AA=GCF_000949855.1; RF=na; TAX=1496; STAX=1496; NAME=Clostridioides difficile; strain=ZJCDC-S82; AL=Scaffold; RT=Major
Sequence
MNISRKAMKIIELAQKIANKRGISVEEAWNEAVTEYKNKYEHIA
Download sequence
Identical sequences A0A1R2EK20 A0A2I2JSY7 D5Q681 D5S2C8 U3UNL3 U3V737 U3V880
WP_003419843.1.11372 WP_003419843.1.13823 WP_003419843.1.16190 WP_003419843.1.17998 WP_003419843.1.19627 WP_003419843.1.21925 WP_003419843.1.21980 WP_003419843.1.22395 WP_003419843.1.27300 WP_003419843.1.27563 WP_003419843.1.29939 WP_003419843.1.32953 WP_003419843.1.33275 WP_003419843.1.35709 WP_003419843.1.40516 WP_003419843.1.46117 WP_003419843.1.48220 WP_003419843.1.48491 WP_003419843.1.48733 WP_003419843.1.49451 WP_003419843.1.50495 WP_003419843.1.51166 WP_003419843.1.52164 WP_003419843.1.53288 WP_003419843.1.62797 WP_003419843.1.63852 WP_003419843.1.63950 WP_003419843.1.65313 WP_003419843.1.70464 WP_003419843.1.73836 WP_003419843.1.74779 WP_003419843.1.79125 WP_003419843.1.79673 WP_003419843.1.80610 WP_003419843.1.8336 WP_003419843.1.83641 WP_003419843.1.84195 WP_003419843.1.84606 WP_003419843.1.8984 WP_003419843.1.90985 WP_003419843.1.93968 WP_003419843.1.97432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]