SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003484392.1.19081 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003484392.1.19081
Domain Number - Region: 17-95
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0247
Family BRCA2 tower domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003484392.1.19081
Sequence length 113
Comment hypothetical protein [Clostridium sporogenes]; AA=GCF_001444595.1; RF=na; TAX=1509; STAX=1509; NAME=Clostridium sporogenes; strain=PA 3679; AL=Contig; RT=Major
Sequence
MDELRNKLIKFREMTLNIIVSLEKEDYDSPRKLLKERELIIKEINNLNYQKEEFKKIDEE
LELLLIEKKLQNLMIEKKAKIKLKLKKASENKEANKNYSTKQFNTQSILNTKI
Download sequence
Identical sequences A0A1V9IN14 J7SFJ0
WP_003484392.1.100330 WP_003484392.1.100585 WP_003484392.1.17118 WP_003484392.1.19081 WP_003484392.1.49610 WP_003484392.1.63039 WP_003484392.1.97471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]