SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003518175.1.6636 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003518175.1.6636
Domain Number 1 Region: 29-457
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.27e-147
Family Cellulases catalytic domain 0.0000000000415
Further Details:      
 
Domain Number 2 Region: 480-554
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-16
Family Type I dockerin domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003518175.1.6636
Sequence length 563
Comment glycoside hydrolase [Ruminiclostridium thermocellum]; AA=GCF_001692755.1; RF=na; TAX=572545; STAX=1515; NAME=Ruminiclostridium thermocellum DSM 2360; strain=LQRI; AL=Complete Genome; RT=Major
Sequence
MRKIAVLLITLTFLVTTLFSMSFSSAAASHDYATALKYSILFYDANKCGPDAAVDNVFSW
RGPCHTTDGSEIGLDLTGGYHDAGDHVKFGLPQAYAAAVLGWSLYEYKGVFDATGNTSKM
LSTLKYFTDYLLKCHPDSNTFYYQVGDGQADHTYWGAPEVQPGPRPVPYVANASNAASDV
CGLTSAALTIMYLNYKDIDQNYANKCLKAAKELYTMAKTNLGYYAENAFYISHSYWDDLS
FAATWLYVVEKDPTYLKEIDSYLSNKTLWGESPFNNKWTMCWDDMYMAVFCKLAEITGEQ
KYIDAMNYNLDYWMNSLNTTPGGLKYLDSWGVLRYAAAEAFIAMRYYELTKNEALKSFAK
SQIDYILGSNPINMSYVIGYGSNYPKCPHHRAANGYTYANGDNAKPAKNLLLGALVGGPN
MSDNFIDDVNQFQFTEVAIDYNAAFVGALAAIEKYYGNIVIPTPPATTPPSPTATPSLIW
CDVGDLNVDGSINSVDITYMKRYLLRSISVLPYQENERIRIPAADTNGDGAINSSDMVLL
KRYVLRSISEFPVKYDIYGNIIN
Download sequence
Identical sequences A3DC34
gi|125972796|ref|YP_001036706.1| 203119.Cthe_0274 gi|385779288|ref|YP_005688453.1| WP_003518175.1.19387 WP_003518175.1.20586 WP_003518175.1.31213 WP_003518175.1.55520 WP_003518175.1.6636 WP_003518175.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]