SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003651537.1.48812 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003651537.1.48812
Domain Number - Region: 48-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.0471
Family HR1 repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003651537.1.48812
Sequence length 100
Comment hypothetical protein [Lactobacillus gasseri]; AA=GCF_001063505.1; RF=na; TAX=1596; STAX=1596; NAME=Lactobacillus gasseri; strain=497_LGAS; AL=Scaffold; RT=Major
Sequence
MRGKINTNDSFIQKLQSDVEKYKTNPERRKELMNYQMKLDDMRYVGEKTGKEEERIDAIK
KMIRRYRQFNADDEKILNLLTQDYGNDFSQEELKQFIKEN
Download sequence
Identical sequences A0A133P8E4
WP_003651537.1.4060 WP_003651537.1.48812 WP_003651537.1.86573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]