SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003667425.1.9381 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003667425.1.9381
Domain Number - Region: 22-62
Classification Level Classification E-value
Superfamily eEF1-gamma domain 0.00706
Family eEF1-gamma domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003667425.1.9381
Sequence length 85
Comment hypothetical protein [Moraxella catarrhalis]; AA=GCF_000192985.1; RF=na; TAX=857576; STAX=480; NAME=Moraxella catarrhalis BC1; strain=BC1; AL=Contig; RT=Major
Sequence
MNYGFSDQALPTYAEANFGGKTRFLPINLVESIGELMIFGDDNDWQIFGLYLQLDNDHHS
YVHIIDPDAEASYRCDVVGTKRIKD
Download sequence
Identical sequences WP_003667425.1.9381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]