SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003675868.1.81448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003675868.1.81448
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000236
Family N-acetyl transferase, NAT 0.013
Further Details:      
 
Weak hits

Sequence:  WP_003675868.1.81448
Domain Number - Region: 135-171
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0654
Family Surp module (SWAP domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003675868.1.81448
Sequence length 184
Comment N-acetyltransferase [Lactobacillus reuteri]; AA=GCF_002128705.1; RF=na; TAX=1598; STAX=1598; NAME=Lactobacillus reuteri; strain=KLR4001; AL=Contig; RT=Major
Sequence
MIEVRQISTKSNDFKNIKRVYNTVFPQNELLPLSLLKMRAKAGKAEFCSIYNEERKWVGF
FYTVYNKRIAYIFFLAIDPHHHGQGLGSATLTAIKERYAGKRITLSAERPDPQAPNNEQR
LRRHRFYAKNGFVKTGLYTVEKGNEKFDLLSTQSNVNPQFYQQLMDSYLTNHRRHYLPYK
IVKE
Download sequence
Identical sequences A0A0S4NM68 A0A1V4FKP4 R9WIM7
gi|512591160|ref|YP_008099002.1| WP_003675868.1.15136 WP_003675868.1.15454 WP_003675868.1.18509 WP_003675868.1.22145 WP_003675868.1.29664 WP_003675868.1.32944 WP_003675868.1.32978 WP_003675868.1.37338 WP_003675868.1.42007 WP_003675868.1.50790 WP_003675868.1.51589 WP_003675868.1.56673 WP_003675868.1.64205 WP_003675868.1.66136 WP_003675868.1.67635 WP_003675868.1.71319 WP_003675868.1.81220 WP_003675868.1.81448 WP_003675868.1.92923 WP_003675868.1.96074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]