SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003702679.1.99703 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003702679.1.99703
Domain Number 1 Region: 6-73
Classification Level Classification E-value
Superfamily Homeodomain-like 2.39e-17
Family Tetracyclin repressor-like, N-terminal domain 0.0058
Further Details:      
 
Weak hits

Sequence:  WP_003702679.1.99703
Domain Number - Region: 149-183
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003702679.1.99703
Sequence length 197
Comment TetR family transcriptional regulator [Lactobacillus salivarius]; AA=GCF_002079845.1; RF=na; TAX=1624; STAX=1624; NAME=Lactobacillus salivarius; strain=AH4231; AL=Scaffold; RT=Major
Sequence
MHQNDLRVRKTRAKIKRALIETINEKGFGNLTVSDITEKAGINRGTFYIHYKGKQDLLEQ
LEEAIYSDIVQLFHDNGTISSATSYEDLNRQFFQKFSAYIYGDRDFILAMVLGNGDPMFY
HKIKQILTRELLKRMEYLGIKMSDEIPHEYIEEYAIGSMLNLSIYWLEKDNPEPPNEFAK
IMMRTRTKAPLAFAVKE
Download sequence
Identical sequences A0A1V9TNJ7
WP_003702679.1.11218 WP_003702679.1.2488 WP_003702679.1.42466 WP_003702679.1.63458 WP_003702679.1.94487 WP_003702679.1.99703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]