SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003716846.1.30754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003716846.1.30754
Domain Number - Region: 14-78
Classification Level Classification E-value
Superfamily VPS9 domain 0.0209
Family VPS9 domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003716846.1.30754
Sequence length 83
Comment hypothetical protein [Lactobacillus vaginalis]; AA=GCF_001435915.1; RF=na; TAX=1423814; STAX=1633; NAME=Lactobacillus vaginalis DSM 5837 = ATCC 49540; strain=DSM 5837; AL=Scaffold; RT=Major
Sequence
MDKDPQNNNERLTRQQYRQQHTTVSNDSEDEQQPFRSRVDQKIEQEQLTNEQKMQRLRKR
LNIAIISLVVAIIIVYLILFFVK
Download sequence
Identical sequences C2ERW5
WP_003716846.1.30393 WP_003716846.1.30754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]