SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003732721.1.85037 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003732721.1.85037
Domain Number - Region: 34-89
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 0.0157
Family DNA-binding protein LAG-1 (CSL) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_003732721.1.85037
Sequence length 145
Comment hypothetical protein [Listeria monocytogenes]; AA=GCF_001751535.1; RF=na; TAX=1639; STAX=1639; NAME=Listeria monocytogenes; strain=CFSAN002265; AL=Scaffold; RT=Major
Sequence
MRYEADFINRFQPLIEEYKLNYKVISEEELALFGSNFALVFSIHFDEVSLNYVCRDKDNL
LVSYDVWSYFLHVFDDKDRENLPKYNSVRERVDVSFLILAKGLPLHWSSVLNGDDKWLED
YKQYKLAGVPRKVIGHLKDSLSLNI
Download sequence
Identical sequences WP_003732721.1.101752 WP_003732721.1.13134 WP_003732721.1.1336 WP_003732721.1.17644 WP_003732721.1.21995 WP_003732721.1.22190 WP_003732721.1.28297 WP_003732721.1.50237 WP_003732721.1.50243 WP_003732721.1.54155 WP_003732721.1.57132 WP_003732721.1.57979 WP_003732721.1.59984 WP_003732721.1.61002 WP_003732721.1.61109 WP_003732721.1.62430 WP_003732721.1.62904 WP_003732721.1.65730 WP_003732721.1.66184 WP_003732721.1.67408 WP_003732721.1.77350 WP_003732721.1.7832 WP_003732721.1.80028 WP_003732721.1.81662 WP_003732721.1.85037 WP_003732721.1.94961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]