SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003884259.1.21576 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003884259.1.21576
Domain Number - Region: 33-53
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0107
Family Antifungal peptide scarabaecin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003884259.1.21576
Sequence length 91
Comment MULTISPECIES: hypothetical protein [Mycobacterium]; AA=GCF_001307545.1; RF=representative genome; TAX=1766; STAX=1766; NAME=Mycobacterium fortuitum; strain=CT6; AL=Complete Genome; RT=Major
Sequence
MNYVIRRLTIVIMAAVASLAAVTAISPAVSSATECGVGTVFDPPSNTCVAAQVPPPPPPP
PPPPAWNGDITPYFSVGVCAPIPFVALCTGI
Download sequence
Identical sequences A0A0A1FY99 A0A0N7H9B2 A0A117ID73 K0VR83
WP_003884259.1.13746 WP_003884259.1.18888 WP_003884259.1.21576 WP_003884259.1.2631 WP_003884259.1.38301 WP_003884259.1.45471 WP_003884259.1.61762 WP_003884259.1.66199 WP_003884259.1.76975 WP_003884259.1.77100 WP_003884259.1.8092 WP_003884259.1.88140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]