SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004025899.1.15075 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004025899.1.15075
Domain Number - Region: 3-43
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00772
Family Typo IV secretion system protein TraC 0.019
Further Details:      
 
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0902
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004025899.1.15075
Sequence length 60
Comment MULTISPECIES: hypothetical protein [Ureaplasma]; AA=GCF_000019345.1; RF=representative genome; TAX=505682; STAX=134821; NAME=Ureaplasma parvum serovar 3 str. ATCC 27815; strain=ATCC 27815; AL=Complete Genome; RT=Major
Sequence
MKNQNEKQIKEYVNKFKDLRNQLTKNNDVKKVCDLINDLFFEVYKNNLIDEVIKEINKHD
Download sequence
Identical sequences A0A2C9DYJ7 B2DAD6 B2NFH2 B2NG29 B3XUN7 B5BNV2 B5ZBK5 B9ZWB1 Q9PQZ3
gi|209554457|ref|YP_002284795.1| 273119.UU151 505682.UPA3_0159 565575.UUR10_0402 WP_004025899.1.11034 WP_004025899.1.11293 WP_004025899.1.14788 WP_004025899.1.15075 WP_004025899.1.47624 WP_004025899.1.48701 WP_004025899.1.54081 WP_004025899.1.72504 WP_004025899.1.78419 WP_004025899.1.96248 gi|13357708|ref|NP_077982.1| gi|170762129|ref|YP_001752234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]