SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004030974.1.34415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004030974.1.34415
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily SRP19 9.03e-26
Family SRP19 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004030974.1.34415
Sequence length 96
Comment signal recognition particle protein Srp19 [Methanobacterium formicicum]; AA=GCF_000302455.1; RF=representative genome; TAX=1204725; STAX=2162; NAME=Methanobacterium formicicum DSM 3637; strain=DSM 3637; AL=Contig; RT=Major
Sequence
MKDETKTIIWPAYIDSTKSKSEGRKIPKKQAVNSPKLREITQAAKKLRLNPSVEKYKSYP
PSWWEGSGRIIIDRNMSKQEVLIKLSNLINGSRKDK
Download sequence
Identical sequences K2R366
WP_004030974.1.34415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]