SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004041731.1.66890 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004041731.1.66890
Domain Number 1 Region: 10-68,209-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.86e-39
Family Bacterial dinuclear zinc exopeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 85-214
Classification Level Classification E-value
Superfamily PA domain 0.000000000122
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004041731.1.66890
Sequence length 444
Comment aminopeptidase [Haloferax volcanii]; AA=GCF_000337315.1; RF=na; TAX=309800; STAX=2246; NAME=Haloferax volcanii DS2; strain=DS2; AL=Contig; RT=Major
Sequence
MDDLSPAVREAFARTWVDDRPWAFLTDLTAIGDRMAGGPGDRRASTLVADAFTDAGVRRV
EFDPFEMARWTRGDTTLDLTAPDERRFEAVALPYAPPATVSGPLVDVGYGTPSEIDAADV
DGALVVASTTTPAGGRFVHRMEKFNYAIGAGAVGFVFVNHVPGQLPPTGALRYDEEAAAP
AVGVSAETGSWLTDYAARGGEATLAVGAETTPGESRNVEGRVGPDTDRELLLCAHFDAHD
IAEGALDNGCGIAVVVTAARLLAEMDLALGVRVVGVGAEELGLTGSEHLADRLDLDRVAA
VVNVDGAGRFRDLVAHSHTSEATAAVATRVGNETRHPVDIEPEPHPFSDQWPFVRAGVPA
LQLRSESGERGRGWGHTHADTRDKVDDRNVREHGMLTALIVRELAATAADGEIPRLDDEL
AAAFRDADFETGMKAAGIWPDGWE
Download sequence
Identical sequences D4GSV2 L9VEG3
WP_004041731.1.66890 WP_004041731.1.84848 gi|292655984|ref|YP_003535881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]