SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004163106.1.50331 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004163106.1.50331
Domain Number 1 Region: 15-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.18e-50
Family PP-loop ATPase 0.00016
Further Details:      
 
Domain Number 2 Region: 215-319
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.79e-24
Family MesJ substrate recognition domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004163106.1.50331
Sequence length 324
Comment tRNA lysidine(34) synthetase TilS [Microcystis aeruginosa]; AA=GCF_000312265.1; RF=na; TAX=1160285; STAX=1126; NAME=Microcystis aeruginosa PCC 9809; strain=PCC 9809; AL=Scaffold; RT=Major
Sequence
MANFWTPLHTRLETTVKKGQLLPKNASLLVALSAGQDSLCLGQLLLDLRSRWGWQLAIAH
CDHRWSSDRGLVTHVRKIAEIWQLPVYITTAPPMAETEAKARQWRYQALQTIAQEQGFNY
LLTAHTRSDRAETFLYNLTRGAGSDGLSALTWLTSLTSDIFLVRPLLNVTRGETFAFCQS
RELPIWYDRANENLRYARNRIRQELLPYLQTNLNPQIEKHLAQTAEILEAESDYLDSIAR
DIFRQVIDLDQQRLDRSPLQILPLAIQRRVIRLFLAQYLPSSPNFAEVESVVNLITGVNR
DATSSLTGKIRVEVQQNWLYISYQ
Download sequence
Identical sequences B0JPI0 I4HGN1
449447.MAE_06690 WP_004163106.1.4043 WP_004163106.1.50331 gi|166363410|ref|YP_001655683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]