SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004398633.1.6517 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004398633.1.6517
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004398633.1.6517
Sequence length 117
Comment MULTISPECIES: anti-sigma F factor antagonist [Bacillus]; AA=GCF_000155325.1; RF=na; TAX=224308; STAX=1423; NAME=Bacillus subtilis subsp. subtilis str. 168; strain=168; AL=Chromosome; RT=Major
Sequence
MSLGIDMNVKESVLCIRLTGELDHHTAETLKQKVTQSLEKDDIRHIVLNLEDLSFMDSSG
LGVILGRYKQIKQIGGEMVVCAISPAVKRLFDMSGLFKIIRFEQSEQQALLTLGVAS
Download sequence
Identical sequences A0A063X7R5 A0A0T8PST1 A0A125UJA8 A0A1Y0WRH9 A0A2J6DY73 L8AMQ8 P10727
gi|430758533|ref|YP_007209113.1| gi|384175961|ref|YP_005557346.1| gi|470162553|ref|YP_007534328.1| NP_390228.1.22788 WP_004398633.1.101301 WP_004398633.1.11088 WP_004398633.1.11257 WP_004398633.1.1140 WP_004398633.1.11581 WP_004398633.1.12644 WP_004398633.1.12759 WP_004398633.1.1358 WP_004398633.1.15902 WP_004398633.1.16291 WP_004398633.1.18944 WP_004398633.1.19261 WP_004398633.1.20099 WP_004398633.1.20502 WP_004398633.1.23108 WP_004398633.1.2546 WP_004398633.1.25531 WP_004398633.1.27372 WP_004398633.1.27612 WP_004398633.1.27660 WP_004398633.1.2914 WP_004398633.1.31028 WP_004398633.1.31786 WP_004398633.1.32025 WP_004398633.1.32219 WP_004398633.1.32420 WP_004398633.1.32693 WP_004398633.1.32861 WP_004398633.1.33285 WP_004398633.1.33846 WP_004398633.1.34621 WP_004398633.1.36189 WP_004398633.1.37074 WP_004398633.1.39605 WP_004398633.1.40859 WP_004398633.1.44140 WP_004398633.1.44184 WP_004398633.1.45019 WP_004398633.1.47157 WP_004398633.1.47672 WP_004398633.1.51783 WP_004398633.1.52847 WP_004398633.1.52860 WP_004398633.1.55792 WP_004398633.1.56274 WP_004398633.1.56411 WP_004398633.1.57156 WP_004398633.1.57184 WP_004398633.1.57201 WP_004398633.1.5726 WP_004398633.1.57513 WP_004398633.1.6139 WP_004398633.1.63795 WP_004398633.1.64889 WP_004398633.1.6517 WP_004398633.1.65188 WP_004398633.1.65223 WP_004398633.1.65841 WP_004398633.1.67028 WP_004398633.1.69439 WP_004398633.1.71402 WP_004398633.1.7159 WP_004398633.1.7186 WP_004398633.1.72999 WP_004398633.1.74782 WP_004398633.1.76977 WP_004398633.1.78686 WP_004398633.1.78811 WP_004398633.1.79288 WP_004398633.1.79712 WP_004398633.1.79987 WP_004398633.1.80832 WP_004398633.1.81116 WP_004398633.1.81747 WP_004398633.1.82722 WP_004398633.1.84183 WP_004398633.1.84434 WP_004398633.1.87300 WP_004398633.1.88042 WP_004398633.1.89821 WP_004398633.1.90830 WP_004398633.1.91060 WP_004398633.1.9164 WP_004398633.1.91723 WP_004398633.1.92915 WP_004398633.1.93073 WP_004398633.1.93420 WP_004398633.1.94199 WP_004398633.1.95009 WP_004398633.1.95211 WP_004398633.1.96043 WP_004398633.1.97264 WP_004398633.1.979 gi|16079404|ref|NP_390228.1| 224308.BSU23470 gi|560129291|ref|YP_008830432.1| gi|402776607|ref|YP_006630551.1| gi|321311823|ref|YP_004204110.1| gi|428279820|ref|YP_005561555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]