SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004406532.1.31208 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004406532.1.31208
Domain Number - Region: 146-212
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.0575
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_004406532.1.31208
Sequence length 238
Comment hypothetical protein [Pseudomonas syringae]; AA=GCF_000145925.1; RF=na; TAX=629270; STAX=317; NAME=Pseudomonas syringae pv. aceris str. M302273; strain=M302273; AL=Scaffold; RT=Major
Sequence
MSALRLRKVDALLAQATRALGAGRRLGFSTRGQRAELSLLPQLEDARIPADGVWLNTAVG
PLLLSDAEALLSLLGEIPFTLGGEHQAWYWQLFNQRLSPAIADLLAPVAPFSDAPTEPAI
GCRVHVRLGSERLDAHLHAAPATLLRLLGSADWQVLKRDVDQSWSVATPLIVGELSLTLE
QIAALRPGDVVLPARCRFDSAGQGTVTLAGRQWAACTDQQAQHLFLQLSHEEHSHHEY
Download sequence
Identical sequences WP_004406532.1.31208 WP_004406532.1.73557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]