SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004430493.1.79721 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004430493.1.79721
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily GAT-like domain 0.0188
Family GAT domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004430493.1.79721
Sequence length 61
Comment MULTISPECIES: hypothetical protein [Bacillus subtilis group]; AA=GCF_000742675.1; RF=na; TAX=1529886; STAX=1452; NAME=Bacillus atrophaeus subsp. globigii; strain=BSS; AL=Chromosome; RT=Major
Sequence
MGNAINNKDQQIDYLKNRLDMFMNVIDSLDPESTDVEDIDRLISMLDDLEAKYERFKKDW
E
Download sequence
Identical sequences A0A080UF58 A0A0H3DWV0 A0A150KQC5
WP_004430493.1.100936 WP_004430493.1.10353 WP_004430493.1.15971 WP_004430493.1.16994 WP_004430493.1.30485 WP_004430493.1.32777 WP_004430493.1.39473 WP_004430493.1.39900 WP_004430493.1.40255 WP_004430493.1.45236 WP_004430493.1.48649 WP_004430493.1.53439 WP_004430493.1.59507 WP_004430493.1.62747 WP_004430493.1.68581 WP_004430493.1.69262 WP_004430493.1.70004 WP_004430493.1.72589 WP_004430493.1.72801 WP_004430493.1.7305 WP_004430493.1.7508 WP_004430493.1.79721 WP_004430493.1.94463 WP_004430493.1.96443 WP_004430493.1.99425 gi|311067284|ref|YP_003972207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]