SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004480912.1.10732 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004480912.1.10732
Domain Number - Region: 4-66
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.0335
Family STAT DNA-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004480912.1.10732
Sequence length 73
Comment hypothetical protein [Leptospira santarosai]; AA=GCF_000348015.1; RF=na; TAX=1218594; STAX=28183; NAME=Leptospira santarosai str. CBC1531; strain=CBC1531; AL=Contig; RT=Major
Sequence
MRIVYEKIFVQKRNDSLILFTDISFTFQVKLMIEPNFITKKRNWKVKNENKKQIQCNKMY
SNYRMFALRELEL
Download sequence
Identical sequences WP_004480912.1.102048 WP_004480912.1.10732 WP_004480912.1.18401 WP_004480912.1.20664 WP_004480912.1.4626 WP_004480912.1.68471 WP_004480912.1.86625 WP_004480912.1.9422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]