SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004673154.1.81846 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004673154.1.81846
Domain Number - Region: 51-84
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0638
Family Cofilin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004673154.1.81846
Sequence length 87
Comment MULTISPECIES: hypothetical protein [Rhizobium]; AA=GCF_001664205.1; RF=na; TAX=396; STAX=396; NAME=Rhizobium phaseoli; strain=R630; AL=Complete Genome; RT=Major
Sequence
MSSSETTTDHKKIRKWAEDREGRPAAIRTRGKGGVLRIDFGEKEEEFDEIDWDEFFKIFD
ENKLAFLYQDKTKDGKTSRFNKFVERN
Download sequence
Identical sequences A0A072C3Z4 A0A0M3GCX1 A0A192PHM1 A0A1W6GRY3 B3Q5A4 F2A7T3
491916.RHECIAT_PC0000305 gi|190894642|ref|YP_001984935.1| gi|190894642|ref|YP_001984935.1|NC_010997 WP_004673154.1.10944 WP_004673154.1.12474 WP_004673154.1.19349 WP_004673154.1.22132 WP_004673154.1.22954 WP_004673154.1.25642 WP_004673154.1.26360 WP_004673154.1.35839 WP_004673154.1.49700 WP_004673154.1.76514 WP_004673154.1.79970 WP_004673154.1.81019 WP_004673154.1.81846 WP_004673154.1.82165 WP_004673154.1.84722 WP_004673154.1.88425 WP_004673154.1.9020 WP_004673154.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]