SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004755102.1.93826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004755102.1.93826
Domain Number - Region: 119-182
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0556
Family Surp module (SWAP domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004755102.1.93826
Sequence length 301
Comment membrane protein [Leptospira kirschneri]; AA=GCF_000306555.1; RF=na; TAX=1193045; STAX=29507; NAME=Leptospira kirschneri str. 200801774; strain=200801774; AL=Contig; RT=Major
Sequence
MIETGIGLFVFSLGCYVWIFASNKPVRNSFFLLTISLAVWLFCLGLRVYAPTEYRSILVN
WTLIPVIFTPYFLHSLVSYLFTPHKKLKEMSWKSIVNIVVLVYLMISILNCNVVHLTKPE
IFAYTPTWIYHLLIGYCSFYVLISSIQVLILIFQKRGDDRVRSFLFFSGIIIALFVSLIF
VYILPLHGYFLASNSAFGIMISSLFWAVAILHYDAFEIREHIIEGDSHLPLLNRISSIPM
LKLFQILDPEEYCNKIVLSKTNVILNVTSVFDELKSREEAKKLNTKERAELLARIFNRRI
R
Download sequence
Identical sequences WP_004755102.1.23137 WP_004755102.1.35806 WP_004755102.1.44102 WP_004755102.1.54193 WP_004755102.1.65494 WP_004755102.1.66883 WP_004755102.1.86808 WP_004755102.1.91961 WP_004755102.1.93826 WP_004755102.1.94075 WP_004755102.1.94556 WP_004755102.1.96304 WP_004755102.1.99539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]